PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00045.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 522aa    MW: 57474.9 Da    PI: 8.5714
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00045.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.91.3e-05190222234
                      zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeH 34 
                                   +++ C+ +++  + l+C+ ++  lC  C    H
  Zmw_sc00045.1.g00210.1.am.mk 190 QQWPCDYCGDAAAALHCRADEARLCVACDRLVH 222
                                   7899******99****************98777 PP

2CCT64.43.4e-22470513144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   R++a++RY+eKrk+R+++K+irYesRK +A++R+RvKGrFvk++
  Zmw_sc00045.1.g00210.1.am.mk 470 RDNAMQRYREKRKNRRYDKHIRYESRKLRADTRKRVKGRFVKST 513
                                   899***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000212.40E-5192223No hitNo description
PfamPF062031.5E-16470512IPR010402CCT domain
PROSITE profilePS5101715.299470512IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MRPHEKVHRS SDNDATMIIL QGEVDTGKSS LATRARRSRR HVSLALFFSS HELWYCLPAW  60
CRLQRLFPEL FVASGQQEGL HTASPFQITV WARSTCWTLT TKPYVDDGPR CQRPARQLGK  120
SREIFSDTRA PAAPPPHHPR QRHVFRGCVR GSAPRRGSEA LPSLPPSCLM HCAARRREPS  180
LLSSVPFWQQ QWPCDYCGDA AAALHCRADE ARLCVACDRL VHAXXXXPVE GFSGCPSAAE  240
LAASWGLDLR GAAGYDDAED DAFFSALDYS MLAAVDPDLR DLYVPCDLPD VAASSVVAGR  300
RLKGEALCHQ LAEMARREVA AHSDLSPRTP RRSSAASRGR LPDKHAPPTL HPPPGPQEVP  360
LPYTSLLMMA STNCPELIGG GDRMAGDDEQ LLWDCAAPSV PPAQVSTGCN RRKVNSCTST  420
IDGPTTSGNH VPTSGPALTW ESSFGDQTVA PAGVERPAMK IDSETLAQNR DNAMQRYREK  480
RKNRRYDKHI RYESRKLRAD TRKRVKGRFV KSTEALDVGN GG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444681.15e-83hypothetical protein SORBIDRAFT_07g025940
TrEMBLC5YHP56e-83C5YHP5_SORBI; Putative uncharacterized protein Sb07g025940
STRINGSb07g025940.12e-82(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45042026